DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
bearsunderland.com
DNS Records
Hosting & Network
bearsunderland.com runs on Namecheap, with DNS by Namecheap and email via Proton.
- Hosting network
- NamecheapAS22612Namecheap
- Managed DNS
- Namecheap
- Proton
- IPv6 (AAAA)
- Not enabled
- CAA pinning
- Set
Sits alongside 620,351 other sites on Namecheap. Stable here since we started watching (Sep 21, 2026).
DNS Records for bearsunderland.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| bearsunderland.com | MX | 0 | 40 | mx2.simplelogin.co |
| bearsunderland.com | MX | 0 | 30 | mx1.simplelogin.co |
| bearsunderland.com | MX | 0 | 10 | mail.protonmail.ch |
| bearsunderland.com | MX | 0 | 20 | mailsec.protonmail.ch |
| bearsunderland.com | A | 0 | 159.198.66.30 | |
| bearsunderland.com | TXT | 0 | keybase-site-verification=rKISwy2bE5wjZeVNuXX1Ur9OHUIKmX_9figms1mtb_Y | |
| bearsunderland.com | TXT | 0 | protonmail-verification=cf8e61ad94a9c5282db3a99f794808290d0a04c8 | |
| bearsunderland.com | TXT | 0 | v=spf1 include:_spf.protonmail.ch mx include:simplelogin.co ~all | |
| bearsunderland.com | TXT | 0 | sl-verification=qrkpsmitcftitmkkvcrmqrqitrcfaa | |
| bearsunderland.com | NS | 0 | pdns2.registrar-servers.com | |
| bearsunderland.com | NS | 0 | pdns1.registrar-servers.com | |
| bearsunderland.com | SOA | 3601 | pdns1.registrar-servers.com hostmaster.registrar-servers.com 1790383354 43200 3600 604800 3601 | |
| bearsunderland.com | CAA | 0 | 0 issue letsencrypt.org | |
| www.bearsunderland.com | CAA | 0 | 0 issue comodoca.com |
Get alerted the moment bearsunderland.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch bearsunderland.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about bearsunderland.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain