DNS Record Lookup

Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain

chryslerkeyreplacementwarren.com

DNS Records

Hosting & Network

chryslerkeyreplacementwarren.com runs on GoDaddy, with email configured.

Hosting network
GoDaddyAS26496GoDaddy
Managed DNS
Self-hosted / other
Email
Configured
IPv6 (AAAA)
Not enabled
CAA pinning
None

Sits alongside 4,999+ other sites on GoDaddy. Stable here since we started watching (Jul 31, 2026).

The apex and www are the same hosting — the apex via A records, www via a CNAME to chryslerkeyreplacementwarren.com.

DNS Records for chryslerkeyreplacementwarren.com

HostnameTypeTTLPriorityContent
chryslerkeyreplacementwarren.comA0184.168.31.57
chryslerkeyreplacementwarren.comTXT0v=spf1 ip4:184.168.31.57 ip4:68.178.205.188 +a +mx +ip4:166.62.88.194 ~all
chryslerkeyreplacementwarren.comNS0ns2.seozonexperts.com
chryslerkeyreplacementwarren.comNS0ns1.seozonexperts.com
chryslerkeyreplacementwarren.comMX0chryslerkeyreplacementwarren.com
chryslerkeyreplacementwarren.comSOA86400ns1.seozonexperts.com allvpsalerts.gmail.com 2026073101 3600 1800 1209600 86400
www.chryslerkeyreplacementwarren.comMX0chryslerkeyreplacementwarren.com
www.chryslerkeyreplacementwarren.comSOA86400ns1.seozonexperts.com allvpsalerts.gmail.com 2026073101 3600 1800 1209600 86400
www.chryslerkeyreplacementwarren.comCNAME0chryslerkeyreplacementwarren.com
www.chryslerkeyreplacementwarren.comTXT0v=spf1 ip4:184.168.31.57 ip4:68.178.205.188 +a +mx +ip4:166.62.88.194 ~all
www.chryslerkeyreplacementwarren.comNS0ns1.seozonexperts.com
www.chryslerkeyreplacementwarren.comNS0ns2.seozonexperts.com
www.chryslerkeyreplacementwarren.comA0184.168.31.57

What's up with DNS →

Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.

Ask about chryslerkeyreplacementwarren.com

Beta

Answers use the live DNS records shown on this page. AI-generated — double-check anything important.

Get alerted the moment chryslerkeyreplacementwarren.com's DNS changes

This page is today's snapshot. Turn on monitoring and we'll watch chryslerkeyreplacementwarren.com continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor DNS free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

About DNS Records

DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:

  • SOA (Start of Authority) - Contains administrative information about the zone
  • NS (Nameserver) - Specifies authoritative nameservers for the domain
  • A (Address) - Maps a domain to an IPv4 address
  • AAAA - Maps a domain to an IPv6 address
  • CNAME (Canonical Name) - Creates an alias pointing to another domain
  • MX (Mail Exchange) - Specifies mail servers for the domain