DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
divinemercypsychiatricfacility.com
DNS Records
Hosting & Network
divinemercypsychiatricfacility.com runs on AS40819, with email configured.
- Hosting network
- AS40819AS40819
- Managed DNS
- Self-hosted / other
- Configured
- IPv6 (AAAA)
- Not enabled
- CAA pinning
- None
Sits alongside 853 other sites on AS40819. Stable here since we started watching (Sep 10, 2026).
The apex and www are the same hosting — the apex via A records, www via a CNAME to divinemercypsychiatricfacility.com.
DNS Records for divinemercypsychiatricfacility.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| divinemercypsychiatricfacility.com | MX | 0 | divinemercypsychiatricfacility.com | |
| divinemercypsychiatricfacility.com | A | 0 | 173.249.146.173 | |
| divinemercypsychiatricfacility.com | NS | 0 | ns3.emergelocal.com | |
| divinemercypsychiatricfacility.com | NS | 0 | ns4.emergelocal.com | |
| divinemercypsychiatricfacility.com | NS | 0 | ns1.webpreneur.com.ph | |
| divinemercypsychiatricfacility.com | NS | 0 | ns2.webpreneur.com.ph | |
| divinemercypsychiatricfacility.com | SOA | 86400 | ns1.webpreneur.com.ph managedalert.futurehosting.com 2026080601 3600 1800 1209600 86400 | |
| www.divinemercypsychiatricfacility.com | MX | 0 | divinemercypsychiatricfacility.com | |
| www.divinemercypsychiatricfacility.com | SOA | 86400 | ns1.webpreneur.com.ph managedalert.futurehosting.com 2026080601 3600 1800 1209600 86400 | |
| www.divinemercypsychiatricfacility.com | CNAME | 0 | divinemercypsychiatricfacility.com | |
| www.divinemercypsychiatricfacility.com | A | 0 | 173.249.146.173 | |
| www.divinemercypsychiatricfacility.com | NS | 0 | ns2.webpreneur.com.ph | |
| www.divinemercypsychiatricfacility.com | NS | 0 | ns4.emergelocal.com | |
| www.divinemercypsychiatricfacility.com | NS | 0 | ns3.emergelocal.com | |
| www.divinemercypsychiatricfacility.com | NS | 0 | ns1.webpreneur.com.ph |
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about divinemercypsychiatricfacility.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
Get alerted the moment divinemercypsychiatricfacility.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch divinemercypsychiatricfacility.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain