DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
DNS Records for geetkarpanditvishweshwarsharma.com
Hostname | Type | TTL | Priority | Content |
---|---|---|---|---|
geetkarpanditvishweshwarsharma.com | SOA | 86400 | ns1.geetkarpanditvishweshwarsharma.com postmaster.geetkarpanditvishweshwarsharma.com 2023071200 21600 3600 86400 86400 | |
geetkarpanditvishweshwarsharma.com | A | 0 | 103.92.235.92 | |
geetkarpanditvishweshwarsharma.com | NS | 0 | ns125.hostingraja.org | |
geetkarpanditvishweshwarsharma.com | NS | 0 | ns126.hostingraja.org | |
geetkarpanditvishweshwarsharma.com | MX | 0 | 10 | mail.geetkarpanditvishweshwarsharma.com |
www.geetkarpanditvishweshwarsharma.com | A | 0 | 103.92.235.92 | |
www.geetkarpanditvishweshwarsharma.com | CNAME | 0 | geetkarpanditvishweshwarsharma.com | |
www.geetkarpanditvishweshwarsharma.com | SOA | 86400 | ns1.geetkarpanditvishweshwarsharma.com postmaster.geetkarpanditvishweshwarsharma.com 2023071200 21600 3600 86400 86400 | |
www.geetkarpanditvishweshwarsharma.com | NS | 0 | ns125.hostingraja.org | |
www.geetkarpanditvishweshwarsharma.com | NS | 0 | ns126.hostingraja.org | |
www.geetkarpanditvishweshwarsharma.com | MX | 0 | 10 | mail.geetkarpanditvishweshwarsharma.com |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain