DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
madawaskavalleyfishandgameclub.ca
DNS Records
DNS Records for madawaskavalleyfishandgameclub.ca
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| madawaskavalleyfishandgameclub.ca | TXT | 0 | v=spf1 +a +mx +ip4:148.113.189.187 include:spf.web-dns1.com -all | |
| madawaskavalleyfishandgameclub.ca | NS | 0 | ns3.whc.ca | |
| madawaskavalleyfishandgameclub.ca | NS | 0 | ns2.whc.ca | |
| madawaskavalleyfishandgameclub.ca | NS | 0 | ns1.whc.ca | |
| madawaskavalleyfishandgameclub.ca | A | 0 | 192.95.37.238 | |
| madawaskavalleyfishandgameclub.ca | SOA | 86400 | ns1.whc.ca sysadmin.whc.ca 2026070103 3600 1800 1209600 86400 | |
| madawaskavalleyfishandgameclub.ca | MX | 0 | mail.madawaskavalleyfishandgameclub.ca | |
| www.madawaskavalleyfishandgameclub.ca | A | 0 | 192.95.37.238 |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain