DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
DNS Records for maheshmetacastindia.com
Hostname | Type | TTL | Priority | Content |
---|---|---|---|---|
maheshmetacastindia.com | NS | 0 | ns2.vinayaksolution.com | |
maheshmetacastindia.com | NS | 0 | ns1.vinayaksolution.com | |
maheshmetacastindia.com | MX | 0 | 10 | mail.maheshmetacastindia.com |
maheshmetacastindia.com | SOA | 10800 | ns1.vinayaksolution.com maheshmetacastindia.vinayakinfosoft.com 2025072001 10800 3600 604800 10800 | |
maheshmetacastindia.com | A | 0 | 101.53.148.4 | |
www.maheshmetacastindia.com | SOA | 10800 | ns1.vinayaksolution.com maheshmetacastindia.vinayakinfosoft.com 2025072001 10800 3600 604800 10800 | |
www.maheshmetacastindia.com | NS | 0 | ns2.vinayaksolution.com | |
www.maheshmetacastindia.com | NS | 0 | ns1.vinayaksolution.com | |
www.maheshmetacastindia.com | CNAME | 0 | maheshmetacastindia.com | |
www.maheshmetacastindia.com | MX | 0 | 10 | mail.maheshmetacastindia.com |
www.maheshmetacastindia.com | A | 0 | 101.53.148.4 |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain