DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
DNS Records for wdeaneastmanfamilyphilanthropies.org
Hostname | Type | TTL | Priority | Content |
---|---|---|---|---|
wdeaneastmanfamilyphilanthropies.org | NS | 0 | ns2.nowallsweb.com | |
wdeaneastmanfamilyphilanthropies.org | NS | 0 | ns1.nowallsweb.com | |
wdeaneastmanfamilyphilanthropies.org | SOA | 86400 | ns1.nowallsweb.com mcgratk.gmail.com 2025082601 86400 7200 3600000 86400 | |
wdeaneastmanfamilyphilanthropies.org | A | 0 | 192.185.189.170 | |
wdeaneastmanfamilyphilanthropies.org | MX | 0 | mail.wdeaneastmanfamilyphilanthropies.org | |
www.wdeaneastmanfamilyphilanthropies.org | SOA | 86400 | ns1.nowallsweb.com mcgratk.gmail.com 2025082601 86400 7200 3600000 86400 | |
www.wdeaneastmanfamilyphilanthropies.org | A | 0 | 192.185.189.170 | |
www.wdeaneastmanfamilyphilanthropies.org | MX | 0 | mail.wdeaneastmanfamilyphilanthropies.org | |
www.wdeaneastmanfamilyphilanthropies.org | NS | 0 | ns1.nowallsweb.com | |
www.wdeaneastmanfamilyphilanthropies.org | NS | 0 | ns2.nowallsweb.com | |
www.wdeaneastmanfamilyphilanthropies.org | CNAME | 0 | wdeaneastmanfamilyphilanthropies.org |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain