RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
karvyfinancialserviceslimited.com
RDAP Information
karvyfinancialserviceslimited.com is registered but isn’t pointed at a website. If it’s yours, use BotBuilt to launch your site in minutes — just describe what you want. If it isn’t, you can still try to buy it here.
Domain Contacts
Registrant Contact
- Contact URI
- https://www.hostinger.com/whois?domain=karvyfinancialserviceslimited.com&view=contact
Registrar Information
- Name
- HOSTINGER operations, UAB
- Handle
- 1636
- Public ID
- 1636
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- Registrar Abuse Contact
- abuse [at] hostinger [dot] com
- Phone
- tel:+1-212-252-2172
Basic Information
- Handle
- 3027642649_DOMAIN_COM-VRSN
- Status
- client transfer prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/karvyfinancialserviceslimited.com
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
- Registrar expiration
RDAP data last fetched
Nameservers
| Hostname | IP Address |
|---|---|
| ns1.cloudwingshost.com | 176.9.80.28 |
| ns2.cloudwingshost.com | 176.9.80.28 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.