DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
hayikamacarpetwashingmachine.com
DNS Records
DNS Records for hayikamacarpetwashingmachine.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| hayikamacarpetwashingmachine.com | SOA | 86400 | ns1.ekolojikweb.com ozkan.ekolojikweb.com 2026062201 3600 1800 1209600 86400 | |
| hayikamacarpetwashingmachine.com | A | 0 | 2.56.61.162 | |
| hayikamacarpetwashingmachine.com | NS | 0 | ns1.ekolojikweb.com | |
| hayikamacarpetwashingmachine.com | NS | 0 | ns2.ekolojikweb.com | |
| hayikamacarpetwashingmachine.com | MX | 0 | hayikamacarpetwashingmachine.com | |
| www.hayikamacarpetwashingmachine.com | SOA | 86400 | ns1.ekolojikweb.com ozkan.ekolojikweb.com 2026062201 3600 1800 1209600 86400 | |
| www.hayikamacarpetwashingmachine.com | A | 0 | 2.56.61.162 | |
| www.hayikamacarpetwashingmachine.com | MX | 0 | hayikamacarpetwashingmachine.com | |
| www.hayikamacarpetwashingmachine.com | CNAME | 0 | hayikamacarpetwashingmachine.com | |
| www.hayikamacarpetwashingmachine.com | NS | 0 | ns1.ekolojikweb.com | |
| www.hayikamacarpetwashingmachine.com | NS | 0 | ns2.ekolojikweb.com |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain