RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain hayikamacarpetwashingmachine.com is registered. You can still try to buy it here.
Domain Contacts
Registrant Contact
- Name
- REDACTED FOR PRIVACY
- Kind
- individual
Registrar Information
- Name
- Isimtescil Bilisim A.S.
- Handle
- 3826
- Public ID
- 3826
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- abuse [at] isimtescil [dot] net
- Phone
- tel:+90.8502000444
Basic Information
- Handle
- 2943539808_DOMAIN_COM-VRSN
- Status
- active
- Resource URL
- https://rdap.verisign.com/com/v1/domain/hayikamacarpetwashingmachine.com
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
RDAP data last fetched
Nameservers
| Hostname | IP Address |
|---|---|
| ns1.ekolojikweb.com | 2.56.61.162 |
| ns2.ekolojikweb.com | 2.56.62.250 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.