DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
DNS Records for jawlaadvancepackagingmachines.com
Hostname | Type | TTL | Priority | Content |
---|---|---|---|---|
jawlaadvancepackagingmachines.com | NS | 0 | ns.tradeindia.com | |
jawlaadvancepackagingmachines.com | SOA | 600 | server1.trade-india.com jawlaadvancepackagingmachines.com 2005091301 10800 3600 604800 600 | |
jawlaadvancepackagingmachines.com | MX | 0 | 10 | mx.jawlaadvancepackagingmachines.com.cust.a.hostedemail.com |
jawlaadvancepackagingmachines.com | A | 0 | 35.200.162.127 | |
www.jawlaadvancepackagingmachines.com | A | 0 | 35.200.162.127 |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain