RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain jawlaadvancepackagingmachines.com is registered. You can still try to buy it here.
Registrar Information
- Name
- Tucows Domains Inc.
- Handle
- 69
- Public ID
- 69
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- TUCOWS, INC.
- Kind
- individual
- domainabuse [at] tucows [dot] com
- Phone
- tel:+1.4165350123
Domain Contacts
Registrant Contact
- Name
- REDACTED REGISTRANT
- Kind
- individual
- Address
- Haryana
- Contact URI
- https://tieredaccess.com/contact/8933658d-5672-4610-a356-2face7dcbb7a
Reseller Contact
- Name
- Infocom Network Private Limited
- Kind
- individual
Basic Information
- Handle
- 2230312820_DOMAIN_COM-VRSN
- Status
- client transfer prohibited, client update prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/jawlaadvancepackagingmachines.com
Important Dates
- Registration
- 2/21/2018
- Expiration
- 2/21/2026
- Last changed
- 11/2/2022
- Last update of RDAP database
- 11/2/2022
Nameservers
Hostname | IP Address |
---|---|
server1.trade-india.com | 3.7.4.123 |
server2.trade-india.com | 3.109.93.93 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.