RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain sanitarynapkinvendingmachine.in is registered. You can still try to buy it here.
Domain Contacts
Registrant Contact
- Organization
- Aajjo.com
- Address
- Delhi
- Country
- India
Administrative Contact
Technical Contact
Billing Contact
Registrar Information
- Name
- Endurance International Group India Private Limited
- Handle
- 801217
- Public ID
- 801217
- Public ID Type
- IANA Registrar ID
- apac-tldadmin [at] endurance [dot] com
- Phone
- tel:+1.2013775952
- Address
- Unit No. 401, 4th Floor, IT Building 3, Nesco IT Park, Nesco Complex, Western Express Highway, Goregaon East, Mumbai Suburban, Mumbai, Maharashtra, 400063
- Country
- India
Registrar Contacts
Abuse Contact
- apac-tldadmin [at] endurance [dot] com
- Phone
- tel:+1.2013775952
Basic Information
- Handle
- D34FC1A0453F045BEB8E03383D01258F7-IN
- Status
- client transfer prohibited
- Resource URL
- https://rdap.nixiregistry.in/rdap/domain/sanitarynapkinvendingmachine.in
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
RDAP data last fetched
Nameservers
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.