Website Uptime Monitor

Monitor website availability and server information for any domain

sanitarynapkinvendingmachine.in

Uptime & Server Information

Current Status

Status
Active
Server Type
Microsoft-IIS/10.0
Page Title
Buy Sanitary Napkin Vending Machine from Top Manufacturers & Sellers - Prices, Specifications, & Reviews
Meta Description
Discover the best deals on sanitary napkin vending machines from top manufacturers and sellers. Compare prices, specifications, and read reviews to make an informed purchase. Get the convenience and hygiene you deserve with a reliable sanitary napkin vending machine.
Meta Keywords
sanitary napkin vending machine, top manufacturers, sellers, prices, specifications, reviews
Most Recent Data
0 hours, 0 minutes ago

Historical Data

DateStatusServer
7/31/2026, 5:56:11 AMActiveMicrosoft-IIS/10.0
7/6/2026, 9:47:01 AMActiveMicrosoft-IIS/10.0
6/28/2026, 8:50:44 PMActiveMicrosoft-IIS/10.0
6/26/2026, 1:18:33 PMInactiveUnknown
6/20/2026, 11:48:56 AMActiveMicrosoft-IIS/10.0
3/15/2026, 5:57:07 AMInactiveUnknown
2/6/2026, 12:58:09 PMInactiveUnknown
1/27/2026, 10:11:59 PMActiveMicrosoft-IIS/10.0
1/18/2026, 3:59:50 AMInactiveUnknown

Don't just check uptime once — watch it 24/7

This is a one-time check. Turn on monitoring and we'll watch the domains that matter to you continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor uptime free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

About Website Uptime Monitoring

Use the Who.is uptime information to track the availability and server information of websites. This helps track:

  • Website availability and response status
  • Server software and configuration
  • Meta information including titles and descriptions
  • Historical uptime patterns

This information is valuable for website owners, system administrators, and anyone interested in monitoring website reliability and performance.

Metrics we monitor

  • Uptime percentage: The percentage of time your website is accessible
  • Response time: How quickly your server responds to requests
  • Status codes: HTTP response codes indicating server status

Disclaimer: Who.is is not affiliated with, endorsed by, or connected to any of the domains displayed on this page. We provide this information as a public service for informational purposes only.